FI domains by business ID
Companies tend to buy domains as soon as they know the name of a project, so do not expect new domains to load a website in the upcoming weeks after GrantDate. It can take months for a website to be planned, designed, built, and published.
| Name | GrantDate | LastValidityDate | Holder | OrganizationId | Address | PostalCode | PostalArea | Country | AssociationType | Registrar | NameServer1 | NameServer2 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| halkivahanmetsastysyhdistys.fi | 2014-08-15 19:42 | 2027-08-15 19:42 | Halkivahan Metsästysyhdistys ry | 0305646-4 | Niitoksentie 53C | 31730 | Honkola | FI | Foundation | HD-decor Oy | ns1.tietokettu.net | ns2.tietokettu.net |
Source: Traficom OData API.
Want to monitor what .fi domains specific companies are buying? The WordPress plugin Domains by Business ID helps you do that!
See also:
- Newest FI domains
- FI domains by business ID
- FI domains by Finnish postal code
- FI domains by registrar
- Expiring FI domains
- Monitoring FI domains
Want to change domain details or remove a domain from this website?
« all tools by Kenda Please support me to create free-to-use tools and open source plugins. Thank you!