FI domains by business ID
Companies tend to buy domains as soon as they know the name of a project, so do not expect new domains to load a website in the upcoming weeks after GrantDate. It can take months for a website to be planned, designed, built, and published.
| Name | GrantDate | LastValidityDate | Holder | OrganizationId | Address | PostalCode | PostalArea | Country | AssociationType | Registrar | NameServer1 | NameServer2 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| syyskarnevaali.fi | 2025-05-09 07:42 | 2027-05-09 07:42 | Etelae-Karjalan Estradi ry | 1788615-1 | Teollisuuskatu 9 | 53600 | Lappeenranta | FI | Company | Zoner Oy | zoner.g1-dns.com | zoner.g1-dns.one |
| lappeenrannansyyskarnevaali.fi | 2025-05-09 07:42 | 2027-05-09 07:42 | Etelae-Karjalan Estradi ry | 1788615-1 | Teollisuuskatu 9 | 53600 | Lappeenranta | FI | Company | Zoner Oy | zoner.g1-dns.com | zoner.g1-dns.one |
| taidekouluestradi.fi | 2012-04-16 10:28 | 2027-04-16 10:28 | Etelä-Karjalan Estradi ry | 1788615-1 | Teollisuuskatu 9 | 53600 | Lappeenranta | FI | Company | Fraidei Oy | ns.pcom.fi | ns1.pcom.fi |
Source: Traficom OData API.
Want to monitor what .fi domains specific companies are buying? The WordPress plugin Domains by Business ID helps you do that!
See also:
- Newest FI domains
- FI domains by business ID
- FI domains by Finnish postal code
- FI domains by registrar
- Expiring FI domains
- Monitoring FI domains
Want to change domain details or remove a domain from this website?
« all tools by Kenda Please support me to create free-to-use tools and open source plugins. Thank you!