FI domains by business ID

Enter a business ID (Y-tunnus in Finnish) to get domains for that organization:

Or select from examples:

Companies tend to buy domains as soon as they know the name of a project, so do not expect new domains to load a website in the upcoming weeks after GrantDate. It can take months for a website to be planned, designed, built, and published.

Name GrantDate LastValidityDate Holder OrganizationId Address PostalCode PostalArea Country AssociationType Registrar NameServer1 NameServer2
syyskarnevaali.fi 2025-05-09 07:42 2027-05-09 07:42 Etelae-Karjalan Estradi ry 1788615-1 Teollisuuskatu 9 53600 Lappeenranta FI Company Zoner Oy zoner.g1-dns.com zoner.g1-dns.one
lappeenrannansyyskarnevaali.fi 2025-05-09 07:42 2027-05-09 07:42 Etelae-Karjalan Estradi ry 1788615-1 Teollisuuskatu 9 53600 Lappeenranta FI Company Zoner Oy zoner.g1-dns.com zoner.g1-dns.one
taidekouluestradi.fi 2012-04-16 10:28 2027-04-16 10:28 Etelä-Karjalan Estradi ry 1788615-1 Teollisuuskatu 9 53600 Lappeenranta FI Company Fraidei Oy ns.pcom.fi ns1.pcom.fi

Source: Traficom OData API.

Want to monitor what .fi domains specific companies are buying? The WordPress plugin Domains by Business ID helps you do that!

See also:

Want to change domain details or remove a domain from this website?

« all tools by Kenda Please support me to create free-to-use tools and open source plugins. Thank you!